DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and Tim17b1

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster


Alignment Length:168 Identity:87/168 - (51%)
Similarity:120/168 - (71%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.|||||||.||.||.:||..|:.:|||||||:||..||.||:..|:.|:..:.|:||
  Fly     3 EYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGNFA 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAA 131
            |||||||.:||:||::|::||.||:|:|||.||||||||.|:.:|.:|||||..:||:|||.|..
  Fly    68 VWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVGIV 132

  Fly   132 VATINA-ADKGAGIVIKPQRAQWEAILET--IDPKRAS 166
            |:..:| :.:....|.:.||.:.|.:.:.  :.|..|:
  Fly   133 VSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLAAT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 81/136 (60%)
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 81/143 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456966
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
109.900

Return to query results.
Submit another query.