DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and timm17a

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_938181.1 Gene:timm17a / 386636 ZFINID:ZDB-GENE-031030-6 Length:166 Species:Danio rerio


Alignment Length:170 Identity:85/170 - (50%)
Similarity:108/170 - (63%) Gaps:10/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.|||:|||.||.||.|||.:|:.:|||||:|:|:..|:.|.:..::.|.|.:.||||
Zfish     3 EYAREPCPWRIVDDCGGAFTMGAIGGGIFQAVKGFRNSPSGMNHRMKGSLTAIRTRAPQLGGSFA 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAA 131
            |||..||.:||.||..|.:||.||||.|||.||.|||||||..||..||.:|.::||:|||||..
Zfish    68 VWGGLFSMIDCGLVKVRGKEDPWNSITSGAMTGAILAARNGPVAMVGSAAMGGILLALIEGAGIL 132

  Fly   132 VATINAADKGAGIVIKPQRAQWEAILETIDPKRASSTQDF 171
            :....:|....|    ||.|:..|      |...||..|:
Zfish   133 LTRFASAQFPTG----PQFAEEPA------PMPTSSFGDY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 75/135 (56%)
timm17aNP_938181.1 Tim17 1..166 CDD:295283 85/170 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.