DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and Timm17b

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038955701.1 Gene:Timm17b / 317374 RGDID:1561744 Length:199 Species:Rattus norvegicus


Alignment Length:163 Identity:78/163 - (47%)
Similarity:98/163 - (60%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.|||:|||.||.||.|||.:|:.:|||||||.|::.|..|.|:.|::|.|.|.||||
  Rat     3 EYAREPCPWRIVDDCGGAFTMGVIGGGVFQAVKGFRNAPVGIRHRFRGSINAVRIRAPQIGGSFA 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARN------------------------- 106
            |||..|||:||.||..|.:||.||||.|||.||.:||||:                         
  Rat    68 VWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSECFQPLTPVLALFCLPFLSCVSFCL 132

  Fly   107 --GIRAMANSALVGCLVLAMIEGAGAAVATINA 137
              |..||..||::|.::||:|||.|..:....|
  Rat   133 PGGPLAMVGSAMMGGILLALIEGVGILLTRYTA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 78/163 (48%)
Timm17bXP_038955701.1 Tim17 1..198 CDD:413300 78/163 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.