DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and tim17

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_593342.1 Gene:tim17 / 2543163 PomBaseID:SPAC3A12.16c Length:164 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:65/137 - (47%)
Similarity:88/137 - (64%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ::.|.|||..|:.|.|.||.||||||:::..:||:||:|.|.:|  ...|...|.|.|.:.|:|.
pombe     5 DHTRDPCPYVILNDFGAAFSMGTIGGAIWHSIKGWRNSPPGEKR--ISAIAAAKTRAPVLGGNFG 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGC-LVLAMIEGAGA 130
            |||..|||.|||:...|::||.||:|::|..|||.||.|.|.||..|.| :|| .:||:.||.|.
pombe    68 VWGGLFSTFDCAVKGVRRKEDPWNAIIAGFFTGGALAVRGGWRATRNGA-IGCACILAVFEGLGI 131

  Fly   131 AVATINA 137
            |:..:||
pombe   132 ALGRMNA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 65/137 (47%)
tim17NP_593342.1 Tim17 3..162 CDD:295283 65/137 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1485
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I1309
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm47021
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.