DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and Timm17b

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_035721.1 Gene:Timm17b / 21855 MGIID:1343176 Length:172 Species:Mus musculus


Alignment Length:136 Identity:77/136 - (56%)
Similarity:98/136 - (72%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.|||:|||.||.||.|||.:|:.:|||||||.|::.|..|.::.|::|.|.|.||||
Mouse     3 EYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGSFA 67

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAA 131
            |||..|||:||.||..|.:||.||||.|||.||.:||||:|..||..||::|.::||:|||.|..
Mouse    68 VWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGIL 132

  Fly   132 VATINA 137
            :....|
Mouse   133 LTRYTA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 77/136 (57%)
Timm17bNP_035721.1 Tim17 1..171 CDD:295283 77/136 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..172
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.