DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17a1 and timm-17B.1

DIOPT Version :9

Sequence 1:NP_001287301.1 Gene:Tim17a1 / 41500 FlyBaseID:FBgn0038018 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_500627.1 Gene:timm-17B.1 / 177242 WormBaseID:WBGene00017119 Length:181 Species:Caenorhabditis elegans


Alignment Length:195 Identity:75/195 - (38%)
Similarity:106/195 - (54%) Gaps:27/195 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGGIDLVKMRTPSIAGSFA 66
            ||.|:|||.||.:|.|.||.||.:|||:|:...|::||..|  ::|.|.:..|:||:......||
 Worm     3 EYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAKG--KKLVGMMREVRMRSTLTGVQFA 65

  Fly    67 VWGATFSTVDCALVHYRQREDAWNSILSGAATGGILAARNGIRAMANSALVGCLVLAMIEGAGAA 131
            .||..|||:||.||..|::||..|||:||..||.:||.|:|.:.||.||::|.::||||||.|..
 Worm    66 AWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVGLV 130

  Fly   132 VATINAADKGAGIVIKPQRAQWEAILETIDPKRASSTQDFALAEFERVLDKCRASREPNLLQDIP 196
            ..      :..|.::.|.:...||:   .||:....                ::..||.|.|..|
 Worm   131 TT------RWMGAMMDPTQPPPEAL---DDPRSLGQ----------------KSQAEPGLDQTRP 170

  Fly   197  196
             Worm   171  170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17a1NP_001287301.1 Tim17 2..138 CDD:295283 64/135 (47%)
timm-17B.1NP_500627.1 3a0801so1tim17 1..172 CDD:130053 75/195 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162482
Domainoid 1 1.000 124 1.000 Domainoid score I3404
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I2720
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm14555
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.850

Return to query results.
Submit another query.