DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and si:dkey-28d5.9

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_021333341.1 Gene:si:dkey-28d5.9 / 799869 ZFINID:ZDB-GENE-060503-449 Length:148 Species:Danio rerio


Alignment Length:142 Identity:31/142 - (21%)
Similarity:51/142 - (35%) Gaps:41/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DWLTARNYCRRRCMDSVSLETSLENEWIKQYVVRENV------------KYIWTSGRLCDFK--- 114
            :|..|:.|||:..:|.||:....||:.:::::...|.            .:.|:......|:   
Zfish     2 NWRDAQRYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAVWIGLFRDSWQWSDQSNSSFRYWK 66

  Fly   115 -GCDRPDLQPTNING---------WFW----TATLQKLAPTTERNQGDWSPT--------GG--- 154
             |..:|.:......|         |||    |...|..||....::.|..||        ||   
Zfish    67 PGEPKPPVDKRCAVGLRHSCALGIWFWVSGQTVCYQNWAPGNGTSEEDCEPTVRSGAVQSGGDQT 131

  Fly   155 -IGLPQPDNREY 165
             |..|:.|...:
Zfish   132 WISRPETDRLNF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 31/142 (22%)
si:dkey-28d5.9XP_021333341.1 CLECT 1..>80 CDD:321932 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.