DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and si:dkeyp-94g1.1

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_009297114.1 Gene:si:dkeyp-94g1.1 / 797092 ZFINID:ZDB-GENE-030131-7910 Length:546 Species:Danio rerio


Alignment Length:220 Identity:37/220 - (16%)
Similarity:65/220 - (29%) Gaps:78/220 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQFQNGRLEPPNPQLC------------AQRVIHEKTPDGKGY--FFSWRDPQLKGVEEDWLTAR 70
            |.:.||  ||.:...|            ...:|:....:|.||  ...|.         :|..|:
Zfish   104 AAWSNG--EPSSTNECGFLAYGNWRTYNCSDLIYFACYNGTGYTMLTMWM---------NWTDAQ 157

  Fly    71 NYCRRRCMDSVSLETSLENEWIKQYVVRENVKYIWTSGRLCDFKGCDRPDLQPTNINGWFWTATL 135
            .|||:..:|..::..|.|...|...|                            :.|.|.|....
Zfish   158 RYCRKHYIDLPTIHNSTELAQINSAV----------------------------SYNAWLWIGLF 194

  Fly   136 QKLAPTTERNQGDWSPTGG-------IGLPQPDNREYKQNGAPENCLALLNQFYNDGVNWHDVAC 193
                    ::..:||...|       :|.|.|       :....:|:.:....:.   .|...:|
Zfish   195 --------KDSWEWSDKWGWFFRYWAVGQPSP-------SAGSSDCVGMSTTNFG---KWASYSC 241

  Fly   194 HHKKSFVCEENDALLKYVRYTNPNL 218
            ..::.|:|..........:|.|.::
Zfish   242 GLQQPFICYGGTKFPYIYQYVNKSM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 23/143 (16%)
si:dkeyp-94g1.1XP_009297114.1 CLECT 30..140 CDD:321932 7/37 (19%)
CLECT 151..250 CDD:321932 23/153 (15%)
CLECT 262..367 CDD:321932 1/5 (20%)
CLECT 372..474 CDD:321932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.