DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and CLEC3B

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:209 Identity:42/209 - (20%)
Similarity:67/209 - (32%) Gaps:80/209 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RLEPPNPQLCAQRVIHEKTPDGKGYFFSWRDPQ--------LKGVE------------EDWLTAR 70
            :|.|.:|.|.|.|    :|...||   :|:..:        |||.:            :.:..|.
Human    45 QLYPLSPTLPALR----RTDPAKG---TWQALEACLGCLVCLKGTKVHMKCFLAFTQTKTFHEAS 102

  Fly    71 NYCRRRCMDSVSLETSLENEWIKQYVVRE--NVKYIWTSGRLCDFKGCDRPDLQPTNINGWFWTA 133
            ..|..|.....:.:|..||:.:.:|:.:.  |...||..                          
Human   103 EDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLG-------------------------- 141

  Fly   134 TLQKLAPTTERNQGDWSPTGGIGL----------PQPDNREYKQNGAPENCLALLNQFYNDGVNW 188
             |..:|.     :|.|....|..:          .|||      .|..||| |:|:...|.  .|
Human   142 -LNDMAA-----EGTWVDMTGARIAYKNWETEITAQPD------GGKTENC-AVLSGAANG--KW 191

  Fly   189 HDVACHHKKSFVCE 202
            .|..|..:..::|:
Human   192 FDKRCRDQLPYICQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 28/148 (19%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 32/169 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.