DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and Sell

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_030108191.1 Gene:Sell / 20343 MGIID:98279 Length:387 Species:Mus musculus


Alignment Length:172 Identity:39/172 - (22%)
Similarity:70/172 - (40%) Gaps:46/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LCAQRVIHEKTPDGKGYFFSWRDPQLKGVEEDWLTARNYCRRRCMDSVSLETSLENEWIKQYVVR 98
            ||...:||..|.... |.:| ..|.      :|..||.:|::...|.|:::...|.|:::. .:.
Mouse    26 LCCDFLIHHGTHCWT-YHYS-EKPM------NWENARKFCKQNYTDLVAIQNKREIEYLEN-TLP 81

  Fly    99 ENVKYIWTS----GRLCDFKGCDRPDLQPTNINGWFWTATLQKLAPTTERNQGDWSPTGGIGLPQ 159
            ::..|.|..    |::                  |.|..|.:.|....|    :|      |..:
Mouse    82 KSPYYYWIGIRKIGKM------------------WTWVGTNKTLTKEAE----NW------GAGE 118

  Fly   160 PDNREYKQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFVC 201
            |:|::.|     |:|:.:..:...|...|:|.|||.:|:.:|
Mouse   119 PNNKKSK-----EDCVEIYIKRERDSGKWNDDACHKRKAALC 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 31/141 (22%)
SellXP_030108191.1 CLECT_selectins_like 39..157 CDD:153062 34/159 (21%)
EGF_CA 160..192 CDD:238011
CCP 197..255 CDD:153056
CCP 259..317 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.