DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and LOC108190604

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_017212437.1 Gene:LOC108190604 / 108190604 -ID:- Length:150 Species:Danio rerio


Alignment Length:117 Identity:30/117 - (25%)
Similarity:46/117 - (39%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WLTARNYCRRRCMDSVSLETSLENEWIKQYVVR-ENVKYIWTSGRLCDFKGCDRPDLQPTNINGW 129
            |..|..|||:..:|.||:: |:|.::....||: .:.:.:|...|    ..|        .:..|
Zfish    42 WSEALRYCRQNHVDLVSVQ-SVEMQYKVMNVVKLASTEAVWLGLR----HSC--------ALGIW 93

  Fly   130 FW----TATLQKLAPTTERNQGDWSPT--------GG----IGLPQPDNREY 165
            ||    |...|..||....::.|..||        ||    |..|:.|...:
Zfish    94 FWVSGETVCYQNWAPGNGTSEEDCEPTVRSGAVQSGGDQTWISRPETDRLNF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 30/117 (26%)
LOC108190604XP_017212437.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.