DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and LOC108179228

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_017206500.1 Gene:LOC108179228 / 108179228 -ID:- Length:322 Species:Danio rerio


Alignment Length:242 Identity:45/242 - (18%)
Similarity:74/242 - (30%) Gaps:104/242 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WLTARNYCRRRCMDSVSLET-------------------------SLENEWIKQYVVRENVKY-- 103
            |..|::|||.|..|..:::|                         .:.|.|:.........||  
Zfish    34 WSDAQSYCRERFTDLATVDTVDDVNRLINTVDAGYSGSVWIGLKREISNHWVWSNGEDTIAKYSD 98

  Fly   104 -----------------IWTS-------GRLC--DFKGCDRPDLQPTNINGWFWTAT-------L 135
                             ||.:       |.||  :|.|. |..|...|     |||.       .
Zfish    99 WAPGEPASGNDCALFNDIWLTTKCSNLYGALCLDEFNGY-RMTLIKMN-----WTAAQSYCRKQF 157

  Fly   136 QKLAPT-TERNQGD-----------WSPTGGIGLPQPD-------NREYK--------QNGAPEN 173
            ..|||. :::|:..           |     |||.:..       |..::        |:....:
Zfish   158 TDLAPIYSKKNKSTLHTLANYLMPLW-----IGLYRDSWKWSDKWNGSFRYWAAGQPFQSAGSVD 217

  Fly   174 CLALLNQFYNDGVNWHDVACHHKKSFVCEENDALLKYVRYTNPNLRI 220
            |:.:..   .|...|...:|..::.|:|..:|   |::|.....|::
Zfish   218 CVGMTT---TDSGKWAPYSCDLQQPFICYGDD---KFIRKQTVRLKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 40/222 (18%)
LOC108179228XP_017206500.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.