DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4115 and si:cabz01083838.1

DIOPT Version :9

Sequence 1:NP_650179.1 Gene:CG4115 / 41499 FlyBaseID:FBgn0038017 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_021330983.1 Gene:si:cabz01083838.1 / 101883056 ZFINID:ZDB-GENE-161017-142 Length:322 Species:Danio rerio


Alignment Length:157 Identity:36/157 - (22%)
Similarity:60/157 - (38%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RDPQLKGVEEDWLTARNYCRRRCMDSVSLETSLENEWIKQYVVRENVKYIWTSGRLCDFKGCDRP 119
            ||..|...::.|:.|:.:||:..:|..::::: |:....|..|.......|..  |.:       
Zfish    22 RDYVLIPQQKTWVQAQTFCRQNHIDLATVQSN-EDYGNLQQTVYNKATMAWIG--LYE------- 76

  Fly   120 DLQPTNINGWFWTATLQKLAPTTERNQGDWSPTGGIGLPQPDNREYKQNGAPENCLALLNQFYND 184
                 :||.|.|:....|:..:|      ||      ..:|:|...|     |.|     ....|
Zfish    77 -----DINSWRWSYRNMKIVFST------WS------AEEPNNFNGK-----EAC-----GLTQD 114

  Fly   185 GVNWHDVACHHKKSFVCEENDALLKYV 211
            | ||:|..|.....|||...:...::|
Zfish   115 G-NWNDWNCSILFPFVCLHENGTDRFV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4115NP_650179.1 CLECT 65..202 CDD:153057 31/136 (23%)
si:cabz01083838.1XP_021330983.1 CLECT 22..130 CDD:321932 33/145 (23%)
CLECT 138..244 CDD:321932 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1038166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.