Sequence 1: | NP_650179.1 | Gene: | CG4115 / 41499 | FlyBaseID: | FBgn0038017 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017212430.1 | Gene: | si:ch211-282j17.7 / 100034556 | ZFINID: | ZDB-GENE-041210-289 | Length: | 366 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 39/195 - (20%) |
---|---|---|---|
Similarity: | 67/195 - (34%) | Gaps: | 60/195 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 GYFFSW------------RDPQLKGVEE--DWLTARNYCRRRCMDSVSLETSLENEWIKQYVVRE 99
Fly 100 NVKYIWTSGRLCDFKGCDRPDLQPTNINGWFWTATLQKLAPTTERNQGDWSPTGGIGLPQPDNRE 164
Fly 165 YKQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFVCEENDAL-----------LKYVRYTNPNL 218
Fly 219 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4115 | NP_650179.1 | CLECT | 65..202 | CDD:153057 | 28/136 (21%) |
si:ch211-282j17.7 | XP_017212430.1 | CLECT_1 | 23..130 | CDD:153072 | 3/16 (19%) |
CLECT | 135..245 | CDD:295302 | 30/144 (21%) | ||
CLECT | 251..363 | CDD:153057 | 4/22 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1038166at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |