Sequence 1: | NP_650179.1 | Gene: | CG4115 / 41499 | FlyBaseID: | FBgn0038017 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093551.1 | Gene: | si:dkey-83f18.3 / 100002910 | ZFINID: | ZDB-GENE-070705-502 | Length: | 361 | Species: | Danio rerio |
Alignment Length: | 221 | Identity: | 41/221 - (18%) |
---|---|---|---|
Similarity: | 77/221 - (34%) | Gaps: | 86/221 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 GKGYFFSWRDPQLKGVEE------------------------------------DWLTARNYCRR 75
Fly 76 RCMDSVSLETSLENEWIKQYVVRENV--KYIWTSGRLCDFKGCDRPDLQPTNINGWFWTATLQKL 138
Fly 139 APTTERNQGDWSPTGGIGLPQPDNREYKQNGAPENCLALLNQFYNDGVNWHDVACHHKKSFVCEE 203
Fly 204 NDAL-----------LKYVRYTNPNL 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4115 | NP_650179.1 | CLECT | 65..202 | CDD:153057 | 28/138 (20%) |
si:dkey-83f18.3 | NP_001093551.1 | CLECT | 23..124 | CDD:295302 | 7/40 (18%) |
CLECT | 127..239 | CDD:295302 | 28/148 (19%) | ||
CLECT | 245..359 | CDD:153057 | 4/22 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1038166at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |