DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD2

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_003918.1 Gene:MBD2 / 8932 HGNCID:6917 Length:411 Species:Homo sapiens


Alignment Length:215 Identity:52/215 - (24%)
Similarity:71/215 - (33%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 GSLGGSSGSSGSKKSKCAPQRRDWPLLDMASLDIASLGLPEIPHDGEWTCHWVNDQPIGTEGFLI 439
            |..||.||..|      ||:|...|.                              |.|:.|   
Human   110 GCGGGGSGGGG------APRREPVPF------------------------------PSGSAG--- 135

  Fly   440 VGEHQKPTVIVQDWR-----LPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFLES 497
             ...:.|.......|     |||||.|....|.:.|  ||.||...|||||:||||..|..:|.:
Human   136 -PGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGN 199

  Fly   498 QNLVYNPDVYDFSIHRRRAKDINAYVYTHGYNPQPPPKPRPMDVSMNSTL---------DQSITS 553
               ..:...:||...:.....:.........:|....|.:|   .:|:||         .|.:|.
Human   200 ---TVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKP---DLNTTLPIRQTASIFKQPVTK 258

  Fly   554 QHSLPSTPMPVKESQYMEAP 573
            ..:.||..:.....:..|.|
Human   259 VTNHPSNKVKSDPQRMNEQP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 26/79 (33%)
PHD_SF 919..963 CDD:304600
MBD2NP_003918.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..158 17/87 (20%)
Necessary for interaction with DHX9. /evidence=ECO:0000269|PubMed:12665568 1..149 14/78 (18%)
MeCP2_MBD 151..214 CDD:238690 25/65 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..241 3/29 (10%)
MBDa 226..292 CDD:406868 12/56 (21%)
MBD_C 297..387 CDD:404858
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.