DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD4

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_003916.1 Gene:MBD4 / 8930 HGNCID:6919 Length:580 Species:Homo sapiens


Alignment Length:459 Identity:91/459 - (19%)
Similarity:158/459 - (34%) Gaps:131/459 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 STGSLGGSSGSSGSKKSKCAPQR--RDWPLLDMASLDIASLGLPEIPHDGEW-------TCHWVN 428
            :||....|.|..|:..:..:.:|  .| |..|:...|:| :.|..:..|.|.       .|:.:.
Human     3 TTGLESLSLGDRGAAPTVTSSERLVPD-PPNDLRKEDVA-MELERVGEDEEQMMIKRSSECNPLL 65

  Fly   429 DQPIGTEGF-LIVGEHQKPTVIVQDWRLPPGWIKHMYQR--SNVLGKWDVILVSPSGKRFRSKSD 490
            .:||.:..| ...|...:.:|       |.||.:.:.||  ....|::||..:||.|.:|||||.
Human    66 QEPIASAQFGATAGTECRKSV-------PCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSS 123

  Fly   491 LKLFL-ESQNLVYNPDVYDFSIHRRRA-----KDINAYVYTHGYNPQPPPKPRPMDVSMNSTLDQ 549
            |..:| ::......|:.:||::..:|.     ||.:....|.....|          |.||..:.
Human   124 LANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQ----------SNNSNWNL 178

  Fly   550 SITSQHSLPSTPMPVKESQYMEAPVASLMPPAELMSPQTQPADET------KPKIEAEILEA--- 605
            ...|:........|...|:..|:...|......|:..:.:..|:.      |||.:..||:.   
Human   179 RTRSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPI 243

  Fly   606 -------------------------------SEGGTSQLMLADPHVVENGFAFIGGLKVKIQDNL 639
                                           ||....:..|.....:.:..|....|.|..::|.
Human   244 KKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETLSVTSEENS 308

  Fly   640 YV--------------------------CPREDCAKTYRKEDFLL--------IHI----RHYH- 665
            .|                          |..:|.....:.||..|        :.:    .|.| 
Human   309 LVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT 373

  Fly   666 ---KEFAEHVSHC-PKMQELAVKRTHPSSIDQVEAVPKNQIPNQQ----FFAKMHQQDLQQSR-- 720
               |..:|..::| |..::...::     |.|.:.:|:.||..::    |.:|.:::.|...|  
Human   374 DILKRGSEMDNNCSPTRKDFTGEK-----IFQEDTIPRTQIERRKTSLYFSSKYNKEALSPPRRK 433

  Fly   721 SFKR 724
            :||:
Human   434 AFKK 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 24/80 (30%)
PHD_SF 919..963 CDD:304600
MBD4NP_003916.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 9/33 (27%)
MBD 79..155 CDD:128673 24/82 (29%)
ENDO3c 450..>520 CDD:304925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12235
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.