DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD12

DIOPT Version :10

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_974851.1 Gene:MBD12 / 833492 AraportID:AT5G35338 Length:155 Species:Arabidopsis thaliana


Alignment Length:83 Identity:23/83 - (27%)
Similarity:35/83 - (42%) Gaps:25/83 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 IPHDGEWTCH-WVNDQPIGTEGFLIVGEHQKPTVIVQDWRLPPGWIKHMYQRSNVLGKWDVILVS 479
            :|.||. ||. |.:..||                       |.||.:.::.||......||....
plant    47 VPQDGT-TCDTWPSIPPI-----------------------PTGWSRSVHIRSESTKFADVYYFP 87

  Fly   480 PSGKRFRSKSDLKLFLES 497
            |||:|.||.::::.||::
plant    88 PSGERLRSSAEVQSFLDN 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 5..84 CDD:461662
MBT_PHF20L1-like 215..282 CDD:439094
Tudor_PHF20-like 288..337 CDD:410457
MeCP2_MBD 449..522 CDD:238690 15/49 (31%)
PHD_SF 919..963 CDD:473978
PRK04778 <1099..>1153 CDD:179877
MBD12NP_974851.1 zf-CW 2..50 CDD:462181 1/2 (50%)
MeCP2_MBD 57..135 CDD:238690 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.