DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MS1

DIOPT Version :10

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_197618.1 Gene:MS1 / 832286 AraportID:AT5G22260 Length:672 Species:Arabidopsis thaliana


Alignment Length:52 Identity:19/52 - (36%)
Similarity:30/52 - (57%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   913 RQEEIINCICEYGEEDG-LMIQCELCLCWQHGACNGIVKEADVPDKYVCYIC 963
            ::::.|.|.|...|||| .|:.|::|..|||..|.|:....:||..::|..|
plant   610 KKDKRIECECGATEEDGERMVCCDICEVWQHTRCVGVQHNEEVPRIFLCQSC 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 5..84 CDD:461662
MBT_PHF20L1-like 215..282 CDD:439094
Tudor_PHF20-like 288..337 CDD:410457
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:473978 17/44 (39%)
PRK04778 <1099..>1153 CDD:179877
MS1NP_197618.1 PHD_MMD1_like 616..661 CDD:277031 17/44 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.