DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and mbd4

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001037916.1 Gene:mbd4 / 733528 XenbaseID:XB-GENE-489215 Length:472 Species:Xenopus tropicalis


Alignment Length:389 Identity:85/389 - (21%)
Similarity:130/389 - (33%) Gaps:110/389 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 VNDQPIGTEGFLIVGEHQKPTVIVQDWRLPPGWIKHMYQRSN--VLGKWDVILVSPSGKRFRSKS 489
            :.|...|.....:...:..|.||..   ||.||.:.:.||.:  ..||:||..|||.|...||:.
 Frog    27 LQDSYTGASYHNVDDRNSSPDVIRS---LPHGWKRIVKQRQSGKTSGKYDVYFVSPQGTTLRSRI 88

  Fly   490 DLKLFLESQNLVYNPDV------YDFSIHRRRAKDINAYVYTHGYNPQPPPKPRPMDVS---MNS 545
            .|..:|.:     |.::      :|||:                  |....|.|....:   .|.
 Frog    89 SLAKYLNN-----NKEINLKLEDFDFSV------------------PDQSQKQRTKKETYRGRNE 130

  Fly   546 TLDQSITSQHSLPSTPMPVKESQYMEAPVASLMPPAELMSPQTQPADETKPKIEAEILEASEGGT 610
            ..||....:::..:....||:|......:.|..                         :||:.| 
 Frog   131 GRDQKEAIENTQYTKETSVKKSTVCRKRIRSHR-------------------------KASDKG- 169

  Fly   611 SQLMLADPHVVENGFAFIGGLKVKIQDNLYVCPREDCAK--TYRKEDFLLIHIRHYHKEFAEHVS 673
                            .|.|..:|.|       |:..::  |.||:. ..|..|...:|..:..|
 Frog   170 ----------------IIEGRPIKRQ-------RKHSSEHLTQRKQK-KAIRSRGPKRELEQKKS 210

  Fly   674 HCPKM---QELAVKRTHPS-SIDQVEAVPKNQIPNQQFFAKMHQQDLQQSRSFKRQSVSATATSS 734
            ...|:   |||.|..|.|| |.|..||         :..:.:.:.|.:.|.:...|:|..|....
 Frog   211 KNNKVNIQQELKVSVTAPSPSCDNEEA---------EILSTLSENDHRCSDTADDQAVPCTPELL 266

  Fly   735 TPSDITPTKALLSPKMEPPSVSPTVESGIKQEDVSLDAGPTQ--SFNPSLSRSCKRARLSPSKR 796
            ..:.|..|.   |........:.|.|   ||.|..:.|...:  ..:|..||...:..|:|.||
 Frog   267 CDAGIEETN---SDSNRDDGDTFTSE---KQTDDFITASQVEKRKTSPYFSRKAIKEALAPPKR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 23/80 (29%)
PHD_SF 919..963 CDD:304600
mbd4NP_001037916.1 MeCP2_MBD 52..112 CDD:238690 22/82 (27%)
ENDO3c 349..>432 CDD:304925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12098
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.