DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and si:ch211-262i1.5

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_021335626.1 Gene:si:ch211-262i1.5 / 567573 ZFINID:ZDB-GENE-030131-3152 Length:485 Species:Danio rerio


Alignment Length:177 Identity:46/177 - (25%)
Similarity:79/177 - (44%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RRCCVANCPSTSRLLEHNGVTYHSFPLDPIIRAIWIKNSRISLERQITKSVLVCSRHFRRLDF-- 65
            |.|||..|..:||.  ::.:::|..|||...|.:|:.|.| ....:::..|.||||||...||  
Zfish    17 RYCCVPFCKISSRF--NSVISFHKLPLDRATRKMWLHNIR-RKTFEVSPHVRVCSRHFTNDDFIE 78

  Fly    66 NTIRNGKYLLKPRVFPTVFPWGKMDTAEIEADQRALQHASVEGTTE---TPGNAQSS-------- 119
            .:....:.|||....||:|.|....|:..:..:...:.||.....|   .|.:.|..        
Zfish    79 PSYPTARRLLKKGAVPTLFRWNNDSTSGQKRFRLWEKKASSSSDQEEELVPMDFQHEDHNYYCTS 143

  Fly   120 --TNDDVIKATVD-----QIVAQILSESAERKATEEGKTGKAADDVK 159
              .||:|:..|.|     :::.:.::|.:..:....|:...:.||::
Zfish   144 RVQNDEVVDPTDDLRNEVEVLKRKVAEFSVNQRFCLGRFAASDDDIR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206 29/83 (35%)
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600
si:ch211-262i1.5XP_021335626.1 THAP 19..97 CDD:310232 28/80 (35%)
HTH_Tnp_4 241..291 CDD:316164
DDE_Tnp_4 319..446 CDD:328798
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11795
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.