DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and NSD3

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_075447.1 Gene:NSD3 / 54904 HGNCID:12767 Length:1437 Species:Homo sapiens


Alignment Length:867 Identity:154/867 - (17%)
Similarity:259/867 - (29%) Gaps:388/867 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 PQPPPKPRPMDVSMNSTLDQSITSQHSLPSTPMPVKES----------------QYMEAPVASLM 578
            |||||.|                   |:|.|.:|.|..                :..|:.:.   
Human   131 PQPPPPP-------------------SVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLC--- 173

  Fly   579 PPAELMSPQTQPADETK-----------------------------PKIEAE--------ILEAS 606
              .:|:: :.|.::.||                             ||:|.|        :...|
Human   174 --GDLLN-EVQASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVS 235

  Fly   607 EGGTSQLMLADPHVVENGFAFI------GGLKVKIQDNLY----VCPREDC-------------- 647
            |....:.:|.:...|:...:.:      .|:|.::.|.::    ..|...|              
Human   236 EKPREEPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI 300

  Fly   648 ----AKTYRKEDF------LLIH---IRHY--HKEFAEHVSHCPKM------------------- 678
                |:.|..:.|      ..:|   :|.|  ||::.|.::...|.                   
Human   301 NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPRPQRER 365

  Fly   679 ---------QELAVKRTHPSSIDQV----------EA-------------VPKNQIPNQQFFAKM 711
                     .|.|:|.|....|:|.          ||             |.|.:.|......:.
Human   366 AQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTRRPRSVLNTQP 430

  Fly   712 HQQDLQQ------SRSFKRQS-------------------VSATATSSTPSDITPTKALLSPKME 751
            .|.:..:      |...:|.|                   .:|.|..|.|:.||..|..|.  ::
Human   431 EQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLD--LQ 493

  Fly   752 PPSVSPTV--------------------------------ESGIKQEDVSLDAGPTQSFNPSLSR 784
            ..::||.|                                |..::.:|..:.:.|.|. |...::
Human   494 KCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQR-NEKPTQ 557

  Fly   785 SCKRARLSPSKRPSGSRKSNRQRSQRRPILSDNPAGHG--------LTEQDVEETRQSFNTPTPD 841
            |     :|..:..|||..|..::.|||.|.:.:.:...        :.::.||...|:    |..
Human   558 S-----VSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIKKEQVETVPQA----TVK 613

  Fly   842 TRI--------DS---KKRRSGAAT---------TPISSIDSPAMGD-------SVSTPSSNDQT 879
            |.:        ||   .|:||.|:|         ...|..||..:.|       .|.:||:....
Human   614 TGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSDLQVGFGKQVDSPSATADA 678

  Fly   880 DINAALAPPPAETLSKAPQYIKENGELIRIVRMRQEEIINCICEYGEEDGLMIQCE-LCLCWQHG 943
            |::...:..  .:||:            |...|.:::.:..|||...:.  :|.|| .|....|.
Human   679 DVSDVQSMD--SSLSR------------RGTGMSKKDTVCQICESSGDS--LIPCEGECCKHFHL 727

  Fly   944 ACNGIVKEADVPD-KYVCYICRNPQR--------GRDSMR--------FKHD------QDWLFEG 985
            .|.|:   |.:|| |::|..|:..|.        |:|..|        |.|:      ...:||.
Human   728 ECLGL---ASLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVRKFPTAIFES 789

  Fly   986 K-------------------------------LPVAAYHT------ANPQATKQFELLKRSHTLT 1013
            |                               .|| |||:      |.......:.|:..:|   
Human   790 KGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPV-AYHSGDACIAAGSMLVSSYILICSNH--- 850

  Fly  1014 GNLLDAKRSMHSLLVKIN---------IARNRCHPKLYLWAKK----WDEDNLDSTALTPVKRAK 1065
                 :|||.:|..|.:.         |.::...|....:|.|    .:|.|            :
Human   851 -----SKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESN------------R 898

  Fly  1066 LEAPDLPNVPQPEAAIDPEECQ 1087
            .|...||.:|...|:  .::|:
Human   899 AELMKLPMIPSSSAS--KKKCE 918

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600 15/45 (33%)
NSD3NP_075447.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..252 11/70 (16%)
PWWP domain; Pfam PF00855 264..324 8/59 (14%)
MSH6_like 267..383 CDD:99898 17/115 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..365 1/20 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..465 7/58 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 540..696 37/179 (21%)
TNG2 <602..746 CDD:227367 39/166 (23%)
PHD type zinc finger motif 697..738 13/45 (29%)
PHD1_NSD3 703..746 CDD:277119 15/47 (32%)
PHD type zinc finger motif 745..795 10/49 (20%)
PHD2_NSD3 751..797 CDD:277122 8/45 (18%)
PHD3_NSD3 798..850 CDD:277125 7/52 (13%)
PHD type zinc finger motif 858..945 13/75 (17%)
PHD4_NSD3 917..952 CDD:277128 1/2 (50%)
PWWP domain; Pfam PF00855 954..1013
WHSC1_related 958..1051 CDD:99899
AWS 1094..1144 CDD:197795
SET 1145..1268 CDD:214614
SET domain 1149..1255
PHD type zinc finger motif 1317..1364
PHD5_NSD3 1323..1365 CDD:277131
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4489
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.