DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD-like

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001262421.1 Gene:MBD-like / 41151 FlyBaseID:FBgn0027950 Length:340 Species:Drosophila melanogaster


Alignment Length:256 Identity:61/256 - (23%)
Similarity:89/256 - (34%) Gaps:70/256 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 TGKAADDVKN---TPESGEDANKAAAKEPSGTPVAASSEATVPAPGSASSSNSPLPGTPPKYSNP 212
            :|.||:.:|.   ..:.|..|..|.|..|:.|   |||.||..|   ||:|    |.|..:....
  Fly   120 SGSAANALKRKFARSQGGNAAGAAGAAPPAAT---ASSAATATA---ASAS----PSTANRQQQQ 174

  Fly   213 HNLTIGARLEALSVEGNWLPARIVEVNETEQTLL--VRFERNHKLKVSPSTSGSFQEWMAIKSER 275
            ..|:     .||..:.:.:|    .:.:|.....  |...||||           |:....|:| 
  Fly   175 IELS-----RALRTDVSLVP----PIRQTASIFKQPVTVIRNHK-----------QDPAKAKNE- 218

  Fly   276 LRQRLSNRVLPVFELDEKCMARWSGPRKFPGTIRKLLGNDTYEVLFDDGYVKNVRAVHMNKMPKQ 340
              .:...|..|.....||.:.|          :|..  :|:.|.|.|....|.:|.|..|     
  Fly   219 --PKHGTREKPKQLFWEKRLER----------LRAC--HDSGEELDDISLPKTIRTVGPN----- 264

  Fly   341 LPPVQVAEEGASKSPTPVGTPVSSAPVAPKRASTGSLGGSSGSSGSKKSKCAPQRRDWPLL 401
                 |.|:          |.:.|...|....:.|..|.||..:...|:..|....:.||:
  Fly   265 -----VNEQ----------TVLQSVATALHMLNAGVHGQSSTKADLTKNAMAFMNPEQPLM 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391 9/36 (25%)
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600
MBD-likeNP_001262421.1 MBD 13..98 CDD:279737
MBDa 172..241 CDD:293172 18/101 (18%)
MBD_C 246..338 CDD:290755 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.