DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Mbd3

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_038935328.1 Gene:Mbd3 / 362834 RGDID:1307389 Length:326 Species:Rattus norvegicus


Alignment Length:292 Identity:60/292 - (20%)
Similarity:108/292 - (36%) Gaps:71/292 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 LPPGWIKHMYQRSNVL--GKWDVI------------LVSPSGKRFRSKSDLKLFL-ESQNLVYNP 504
            ||.||.:....|.:.|  |..||.            |.|||||:||||..|..:| .|.:|    
  Rat    11 LPQGWEREEVPRRSGLSAGHRDVFYYRAGDRTQGLALPSPSGKKFRSKPQLARYLGGSMDL---- 71

  Fly   505 DVYDFSIHRRRAKDINAYVYTHGYNPQPPPK------PRPMDVSMN--STLDQSITSQHSLP--S 559
            ..:||...:.....:|.......|:.....|      |.|.:.|..  ......:.|....|  :
  Rat    72 STFDFRTGKMLMNKMNKSRQRVRYDSSNQVKALAKHLPGPSNPSWTPVGAARCRVFSPQGKPDLN 136

  Fly   560 TPMPVKE-SQYMEAPVASLM--PPAELMSPQTQPADETKP-------------KIEAEILEASE- 607
            |.:||:: :...:.||..:.  |..::.|...:..|:.:.             .|..|::...: 
  Rat   137 TALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDL 201

  Fly   608 ---------GGTSQLMLA--DPHVVENGFAFIGGLKVKIQDN--LYVCPREDCAKTY-------R 652
                     |.|.:.:|:  ...:..:.....|.|...::.|  :::...:...|.:       |
  Rat   202 PKGLQGVGPGCTDETLLSAIASALHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIR 266

  Fly   653 KEDFLLIHIRHYHKE--FAEHVSHCPKMQELA 682
            |::.|:..:|...:|  .|:.::|   ::|||
  Rat   267 KQEELVQQVRKRLEEALMADMLAH---VEELA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 26/81 (32%)
PHD_SF 919..963 CDD:304600
Mbd3XP_038935328.1 MeCP2_MBD 5..91 CDD:238690 26/83 (31%)
MBDa 131..188 CDD:406868 9/56 (16%)
MBD_C 193..283 CDD:404858 13/89 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.