DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Phf23

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_006246809.1 Gene:Phf23 / 360550 RGDID:1302969 Length:401 Species:Rattus norvegicus


Alignment Length:325 Identity:68/325 - (20%)
Similarity:109/325 - (33%) Gaps:85/325 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 DLQQSRSF--KRQSVSATATSSTPSDITPTKALLSPKMEPPSVSPTVESGIKQEDVSLDAGP--T 775
            ||:..::|  |.:|....|..:.|:...|.::..|....|.|.:...:..:|.....|| ||  .
  Rat    83 DLRTIQTFVKKAKSSKRRAAQAGPTQPGPPRSTFSRLQAPDSATLLEKMKLKDSLFDLD-GPKVA 146

  Fly   776 QSFNPSLSRSCKRARLSPSKRPSGSRKSNRQRSQR-RPILSDNPAGHGLTEQDVEETRQSFNTPT 839
            ...:|:...|...|.|:|.....|.....|::.:: |.:.....||.|:..:.         .|.
  Rat   147 SPLSPTSLTSRPPAALTPVPLSQGDLSQPRKKDRKNRKLGPGGGAGFGVLRRP---------RPA 202

  Fly   840 PD-----TRIDSKKRRS-------------GAATTPISSIDSPAMGDSVSTPSSNDQT------D 880
            |.     :||...|:|.             |....|.|..||....:........::|      .
  Rat   203 PGDGEKRSRIKKSKKRKLKKADRGDRLPPPGPPRAPPSDTDSEEEEEEEEEEDDEEETTVVGGGG 267

  Fly   881 INAALAPPPAETLSKAPQYI---------------------------KENGELIRIVRMRQEEI- 917
            :.|.:.|.|.|. .:.|..:                           ...||:    |:..|:| 
  Rat   268 VPAPVLPTPPEA-PRPPVTVHPEGAPPTDSEGKDAGSTETSQDGDGSSSEGEM----RVMDEDIM 327

  Fly   918 ----------INCICEYGEEDGLMIQCELCLCWQHGACNGIVKEADVPDKYVCYICR--NPQRGR 970
                      |.|.|........||:|.||..|.|.:| ..:|:.:|||.:.|..|:  .|:..|
  Rat   328 VESGDDSWDLITCYCRKPFAGRPMIECSLCGTWIHLSC-AKIKKTNVPDFFYCQKCKELRPEARR 391

  Fly   971  970
              Rat   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600 15/43 (35%)
Phf23XP_006246809.1 PHD_PHF23 339..382 CDD:277101 15/43 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.