DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and mbd-2

DIOPT Version :10

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001021012.1 Gene:mbd-2 / 3565704 WormBaseID:WBGene00023409 Length:210 Species:Caenorhabditis elegans


Alignment Length:88 Identity:19/88 - (21%)
Similarity:38/88 - (43%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 QPEAAIDPEEC---QYRLIEHIKVQQSLVLDRLNDIEAEMDELEKEDTLDDLKDADIS------- 1130
            |||..:..:|.   :.|....::..|::....|:.::..:.. ||.|.:.|:|.|:.|       
 Worm    56 QPETKVQNDELLKRRSRRKTEMRPFQAMWAKSLSGLQVSIPH-EKPDRIGDVKKAEYSYESIKKI 119

  Fly  1131 ----------TTKEALATFIKEL 1143
                      |.:||:.|.|:::
 Worm   120 SLIKPGVSAFTPEEAMTTVIQQM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 5..84 CDD:461662
MBT_PHF20L1-like 215..282 CDD:439094
Tudor_PHF20-like 288..337 CDD:410457
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:473978
PRK04778 <1099..>1153 CDD:179877 13/62 (21%)
mbd-2NP_001021012.1 MBD_C 112..206 CDD:464072 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.