DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and mbd-2

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001021012.1 Gene:mbd-2 / 3565704 WormBaseID:WBGene00023409 Length:210 Species:Caenorhabditis elegans


Alignment Length:88 Identity:19/88 - (21%)
Similarity:38/88 - (43%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 QPEAAIDPEEC---QYRLIEHIKVQQSLVLDRLNDIEAEMDELEKEDTLDDLKDADIS------- 1130
            |||..:..:|.   :.|....::..|::....|:.::..:.. ||.|.:.|:|.|:.|       
 Worm    56 QPETKVQNDELLKRRSRRKTEMRPFQAMWAKSLSGLQVSIPH-EKPDRIGDVKKAEYSYESIKKI 119

  Fly  1131 ----------TTKEALATFIKEL 1143
                      |.:||:.|.|:::
 Worm   120 SLIKPGVSAFTPEEAMTTVIQQM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600
mbd-2NP_001021012.1 MBD_C 113..206 CDD:372891 5/30 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.