DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and mbd3b

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_005170489.1 Gene:mbd3b / 321217 ZFINID:ZDB-GENE-030131-9792 Length:265 Species:Danio rerio


Alignment Length:217 Identity:43/217 - (19%)
Similarity:76/217 - (35%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 SVSPTVESGIKQEDVSLDAGPTQSFNPSLSRSCKRARLSPSKRPSGSRKSNRQRSQRRPILSDNP 818
            |:.||.:....:..::...|.:...:....|:.|......:|.....|..|..:|:.:|.|:   
Zfish    26 SLCPTGKKFRSKPQLARSLGNSMDLSSFDFRTGKMLMSKLNKNRQRPRYDNNSQSKGKPDLN--- 87

  Fly   819 AGHGLTEQDVEETRQSFNTPT--------------PDTRIDS------KKRRSG-----AATTPI 858
                 |...|.:|...|..|.              |...||.      :|:.||     .|...:
Zfish    88 -----TSLPVRQTASIFKQPVTKVTNHPSNKVKTDPQKAIDQPRQLFWEKKLSGLNAFDIAEELV 147

  Fly   859 SSIDSP-----------------AMGDSVSTPSSNDQTDINAALAPPP------AETLSKA---- 896
            .::|.|                 |:..::.|.::.....::||:...|      |:.|.||    
Zfish   148 KTMDLPKGLQGVGPGCTDKTLLSAIASALHTSAAPITGQLSAAVEKNPGVWLNTAQPLCKAFIVT 212

  Fly   897 PQYIKENGELIRIVRMRQEEII 918
            .:.|::..||:..||.|.||.:
Zfish   213 DEDIRKQEELVYSVRKRLEEAL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600 43/217 (20%)
mbd3bXP_005170489.1 MBD <29..69 CDD:294079 6/39 (15%)
MBDa 74..139 CDD:293172 15/72 (21%)
MBD_C 144..234 CDD:290755 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.