DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD3L5

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001129979.1 Gene:MBD3L5 / 284428 HGNCID:37204 Length:208 Species:Homo sapiens


Alignment Length:165 Identity:30/165 - (18%)
Similarity:65/165 - (39%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 IHIRHYHKEFAEHVSHCPKMQELAVKRTHPSSIDQVEAVPKNQIPNQQFFAKMHQQDLQQSRSFK 723
            ||:...|:..|...:...::.....:|    .:.::.:.|.||:..::  ...|.:..||..:::
Human    33 IHMAKAHRRRAARSALPMRLTSCIFRR----PVTRIRSHPDNQVRRRK--GDEHLEKPQQLCAYR 91

  Fly   724 R----QSVSATATSSTPSDITPTKALLSPKMEPPSVSPTVESGIKQEDVSLD----------AGP 774
            |    |..|:....|:|..:....::|:|.....|:.   .:|.::..:.|:          .||
Human    92 RLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD---RAGAERVRIPLEPTPGRFPAVAGGP 153

  Fly   775 TQSFNPSLSRSCKRARLSPS--KRPSGSRKSNRQR 807
            |......|........::|:  :|.:...|..|:|
Human   154 TPGMGCQLPPPLSGQLVTPADIRRQARRVKKARER 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600
MBD3L5NP_001129979.1 MBDa <48..97 CDD:293172 8/54 (15%)
MBD_C 103..193 CDD:290755 16/89 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.