DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and MBD3L5

DIOPT Version :10

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001129979.1 Gene:MBD3L5 / 284428 HGNCID:37204 Length:208 Species:Homo sapiens


Alignment Length:165 Identity:30/165 - (18%)
Similarity:65/165 - (39%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 IHIRHYHKEFAEHVSHCPKMQELAVKRTHPSSIDQVEAVPKNQIPNQQFFAKMHQQDLQQSRSFK 723
            ||:...|:..|...:...::.....:|    .:.::.:.|.||:..::  ...|.:..||..:::
Human    33 IHMAKAHRRRAARSALPMRLTSCIFRR----PVTRIRSHPDNQVRRRK--GDEHLEKPQQLCAYR 91

  Fly   724 R----QSVSATATSSTPSDITPTKALLSPKMEPPSVSPTVESGIKQEDVSLD----------AGP 774
            |    |..|:....|:|..:....::|:|.....|:.   .:|.::..:.|:          .||
Human    92 RLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLD---RAGAERVRIPLEPTPGRFPAVAGGP 153

  Fly   775 TQSFNPSLSRSCKRARLSPS--KRPSGSRKSNRQR 807
            |......|........::|:  :|.:...|..|:|
Human   154 TPGMGCQLPPPLSGQLVTPADIRRQARRVKKARER 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 5..84 CDD:461662
MBT_PHF20L1-like 215..282 CDD:439094
Tudor_PHF20-like 288..337 CDD:410457
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:473978
PRK04778 <1099..>1153 CDD:179877
MBD3L5NP_001129979.1 MBDa <48..97 CDD:465179 8/54 (15%)
MBD_C 102..193 CDD:464072 16/90 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.