DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Phf13

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_766293.2 Gene:Phf13 / 230936 MGIID:2446217 Length:296 Species:Mus musculus


Alignment Length:254 Identity:60/254 - (23%)
Similarity:97/254 - (38%) Gaps:59/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 PKMEPP---SVSPTVESGIKQEDVSLDAG--------PTQSFN---PSLSRSCKRARLSPSKRPS 798
            ||.|.|   |.||...:....:....|.|        |.:.|:   |||.:..|.:.....::.:
Mouse    45 PKEELPLRSSPSPANSTAGTIDSDGWDTGFSDITPSVPDRCFSHLQPSLLQRAKPSNYLLDRKTT 109

  Fly   799 GSRKSNRQRSQRRPILSDNPAGHGLTEQ--DVEETRQSFNTPTPDTRIDSKKRRSGAATTPISSI 861
            ...|..::|.:|.   ||.|...|..|.  .:|.......||:..|..|..:    |:..|.|..
Mouse   110 DKLKKKKRRKRRD---SDIPVKEGFRESLLKLEAADPYVETPSSPTMQDIPQ----ASADPCSGW 167

  Fly   862 DS--PAMGDSVSTPSSNDQTDINAALAPPPAETLSKAPQYIKENGELIRIVRMRQE--------- 915
            ||  |:.| |.:|.|.:..|:|.           ::..:.|...|   :.|..|.|         
Mouse   168 DSDTPSSG-SCATVSPDQVTEIK-----------TEGKRTIVRQG---KQVVFRDEDSTGNDEDI 217

  Fly   916 ---------EIINCICEYGEEDGLMIQCELCLCWQHGACNGIVKEADVPDKYVCYICRN 965
                     :::.|.|........||:|..|..|.|.:| ..:::::||:.:||..||:
Mouse   218 MVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSC-AKIRKSNVPEVFVCQKCRD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600 13/43 (30%)
Phf13NP_766293.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..73 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..126 6/31 (19%)
Nuclear localization signal. /evidence=ECO:0000250 106..123 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..183 14/42 (33%)
PHD_PHF13 228..274 CDD:277102 13/46 (28%)
Interaction with trimethylated histone H3 (H3K4). /evidence=ECO:0000250 237..244 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.