DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Y14H12B.2

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_494697.1 Gene:Y14H12B.2 / 173735 WormBaseID:WBGene00021192 Length:414 Species:Caenorhabditis elegans


Alignment Length:320 Identity:64/320 - (20%)
Similarity:112/320 - (35%) Gaps:91/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 ILEASEGGTSQLMLAD---PHVVENGF-AFIGGLKVKIQDNLYV-----CPREDCAK-------- 649
            :.:.|:..:..|||.|   .:..|.|: ..:..|::|::.:|.|     ...||..|        
 Worm    31 LAKKSKNISRPLMLKDLFSAYKEEAGYPGTVATLRLKLRWDLAVKIPLAANFEDDEKAQMLFATS 95

  Fly   650 TYRKEDFLLIHIRHYHKEFAEHVSHCPKMQELAVKRTHPSSIDQVEAVPKNQIPNQQF---FAKM 711
            |..||:||                     :.|..|.|  ..:|.::.:...:....:|   .||.
 Worm    96 TSAKEEFL---------------------KRLREKAT--VDVDNLQRITYYKSTKLEFKGKHAKG 137

  Fly   712 HQQDLQQSRSFKRQSVSATATSSTPSDITPTKALLSPKMEPPSVSPTVESGIKQEDVSLDAGPTQ 776
            :..||.|.||   .|.|..:.:.:|           |:::..:.:...|...:.|.:.:|    |
 Worm   138 NFADLSQRRS---SSASNQSVAQSP-----------PQLQQINSADLQEEEDEDEIIVID----Q 184

  Fly   777 SFNPSLSRSCKRARLSPSKRPSGSRKSNRQRSQRRPILSDNPAGHGLTEQDVEETRQSFNTPTPD 841
            :.||:::            .|...:.:.:...|...|  |.|...|.....|......::...|.
 Worm   185 TSNPAIN------------YPKMKQIAVKTEFQEPRI--DYPPSDGSDTISVINVNAGYSLYCPQ 235

  Fly   842 TRIDSKKRRS-----GAATTPISSIDSPAMGDSVSTPSSNDQTDINAALAPPPA--ETLS 894
            ........||     |...|.:..:.|..|.:.::..|::         |||||  ||.|
 Worm   236 PAFYPNVDRSMFTAMGQMMTGVLQMQSQMMKEVLNRGSTS---------APPPAAPETTS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600
Y14H12B.2NP_494697.1 SPK 27..131 CDD:367941 23/122 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.