DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Mecp2

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_001075448.1 Gene:Mecp2 / 17257 MGIID:99918 Length:501 Species:Mus musculus


Alignment Length:697 Identity:132/697 - (18%)
Similarity:200/697 - (28%) Gaps:288/697 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 SPSTSGSFQEWMAIKSERLRQRLSNRVLPVFELDEKCMARWSGPRKFPGTIRKLLGNDTYEVLFD 322
            :||..|...|     .|||.::..::.|.  .|.:|       |.||     |....|..|    
Mouse    13 APSGGGGGGE-----EERLEEKSEDQDLQ--GLRDK-------PLKF-----KKAKKDKKE---- 54

  Fly   323 DGYVKNVRAVHMNKMPKQLPPVQVAEEGASKSPTPVGTPVSSAPVAPKRASTGSLGGSSGSSGSK 387
                 :....|....|......:.||.|.:::....|    |||..|:            :|.|.
Mouse    55 -----DKEGKHEPLQPSAHHSAEPAEAGKAETSESSG----SAPAVPE------------ASASP 98

  Fly   388 KSKCAPQRRDWPLLDMASLDIASLGLPEIPHDGEWTCHWVNDQPIGTEGFLIVGEHQKPTVIVQD 452
            |.:.:..|...|:.|                                          .||     
Mouse    99 KQRRSIIRDRGPMYD------------------------------------------DPT----- 116

  Fly   453 WRLPPGWIKHMYQRSN--VLGKWDVILVSPSGKRFRSKSDLKLFLES-QNLVYNPDVYDFSI--- 511
              ||.||.:.:.||.:  ..||:||.|::|.||.||||.:|..:.|. .:...:|:.:||::   
Mouse   117 --LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGR 179

  Fly   512 ---HRRRAKDINAYVYTHGYNPQPPPKPRPMDVSMNSTLDQSITSQHSLPSTPMPVKESQYMEAP 573
               .||..|              ||.||:                                  :|
Mouse   180 GSPSRREQK--------------PPKKPK----------------------------------SP 196

  Fly   574 VASLMPPAELMSPQTQPADETKPKIEA-------EILEASEGGTSQLMLADPHVVENGFAFIGGL 631
            .|   |.......:.:.:...:||..|       .:||.|.|   :|::..|.....|....|| 
Mouse   197 KA---PGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPG---KLVVKMPFQASPGGKGEGG- 254

  Fly   632 KVKIQDNLYVCPREDCAKTYRKEDFLLIHIRHYHKEFAEHVSHCPKMQELAVKRTHPSSIDQVEA 696
                                                     ......|.:.:||  |....:.||
Mouse   255 -----------------------------------------GATTSAQVMVIKR--PGRKRKAEA 276

  Fly   697 VPKNQIPNQQFFAKMHQQDLQQSRSFKRQSVSATATSSTPSDITPTKALLSPKMEPPSVSPTV-- 759
            .|               |.:.:.|..|..||.|.|.:....     ||:....:.  ||..||  
Mouse   277 DP---------------QAIPKKRGRKPGSVVAAAAAEAKK-----KAVKESSIR--SVHETVLP 319

  Fly   760 -ESGIKQEDVSLDAGPTQSFNPSL-----------SRSCKRARLSPSKRPSGSRKSNRQRSQRRP 812
             :....:|.||::.  .:...|.|           .::||    ||.::...|....|..|...|
Mouse   320 IKKRKTRETVSIEV--KEVVKPLLVSTLGEKSGKGLKTCK----SPGRKSKESSPKGRSSSASSP 378

  Fly   813 ILSDNPAGHGLTEQ--------------DVEETRQSFNTPTPDTRIDS-----KKRRSGAATTPI 858
            ...::...|..:|.              :.|.:....:.|.|.....|     |..|.|:.    
Mouse   379 PKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSL---- 439

  Fly   859 SSIDSPAMGDSVSTPSSNDQTDINAALAPPPAETLSKAPQYIKENGE 905
                     :|...|....:|.      |..|.|.:.|.:| |..||
Mouse   440 ---------ESDGCPKEPAKTQ------PMVATTTTVAEKY-KHRGE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391 7/36 (19%)
MeCP2_MBD 449..522 CDD:238690 26/81 (32%)
PHD_SF 919..963 CDD:304600
Mecp2NP_001075448.1 MBD 109..186 CDD:128673 28/125 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12132
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.