DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Mbd3

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_038623.1 Gene:Mbd3 / 17192 MGIID:1333812 Length:285 Species:Mus musculus


Alignment Length:272 Identity:60/272 - (22%)
Similarity:98/272 - (36%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 LPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFL-ESQNLVYNPDVYDFSIHRRRA 516
            ||.||.:....|.:.|  |..||...|||||:||||..|..:| .|.:|    ..:||...:...
Mouse    11 LPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDL----STFDFRTGKMLM 71

  Fly   517 KDINAYVYTHGYNPQPPPKPRPMDVSMNSTL---------DQSITSQHSLPSTPMPVKESQYMEA 572
            ..:|.......|:.....|.:|   .:|:.|         .|.:|...:.||..:.....:.::.
Mouse    72 NKMNKSRQRVRYDSSNQVKGKP---DLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQ 133

  Fly   573 P---------------------VASLMPPAELMSPQTQPADETKPKIEAEILEASEGGTSQLMLA 616
            |                     |.::..|..|........|||.....|..|.     ||.|.:.
Mouse   134 PRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALH-----TSTLPIT 193

  Fly   617 DPHVVENGFAFIGGLKVKIQDN--LYVCPREDCAKTY-------RKEDFLLIHIRHYHKE--FAE 670
                        |.|...::.|  :::...:...|.:       ||::.|:..:|...:|  .|:
Mouse   194 ------------GQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALMAD 246

  Fly   671 HVSHCPKMQELA 682
            .::|   ::|||
Mouse   247 MLAH---VEELA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 25/69 (36%)
PHD_SF 919..963 CDD:304600
Mbd3NP_038623.1 MeCP2_MBD 5..79 CDD:238690 25/71 (35%)
MBDa 83..148 CDD:374634 10/67 (15%)
MBD_C 153..243 CDD:372891 20/106 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..285 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.