DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Mbd2

DIOPT Version :10

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_034903.2 Gene:Mbd2 / 17191 MGIID:1333813 Length:414 Species:Mus musculus


Alignment Length:212 Identity:50/212 - (23%)
Similarity:70/212 - (33%) Gaps:56/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 GGSSGSSGSKKSKCAPQRRDWPLLDMASLDIASLGLPEIPHDGEWTCHWVNDQPIGTEGFLIVGE 442
            ||:.|..|......||:|...|.                              |.|:.|    ..
Mouse   110 GGAGGCGGGSGGGVAPRRDPVPF------------------------------PSGSSG----PG 140

  Fly   443 HQKPTVIVQDWR-----LPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFLESQNL 500
            .:.|.......|     |||||.|....|.:.|  ||.||...|||||:||||..|..:|.:   
Mouse   141 PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGN--- 202

  Fly   501 VYNPDVYDFSIHRRRAKDINAYVYTHGYNPQPPPKPRPMDVSMNSTL---------DQSITSQHS 556
            ..:...:||...:.....:.........:|....|.:|   .:|:||         .|.:|...:
Mouse   203 AVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKP---DLNTTLPIRQTASIFKQPVTKFTN 264

  Fly   557 LPSTPMPVKESQYMEAP 573
            .||..:.....:..|.|
Mouse   265 HPSNKVKSDPQRMNEQP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 5..84 CDD:461662
MBT_PHF20L1-like 215..282 CDD:439094
Tudor_PHF20-like 288..337 CDD:410457
MeCP2_MBD 449..522 CDD:238690 26/79 (33%)
PHD_SF 919..963 CDD:473978
PRK04778 <1099..>1153 CDD:179877
Mbd2NP_034903.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..163 17/86 (20%)
Required for interaction with DHX9 and PRMT5. /evidence=ECO:0000250|UniProtKB:Q9UBB5 1..152 12/75 (16%)
MeCP2_MBD 154..217 CDD:238690 25/65 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..244 3/29 (10%)
MBDa 229..295 CDD:465179 12/56 (21%)
MBD_C 299..390 CDD:464072
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.