DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and Mbd2

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:NP_034903.2 Gene:Mbd2 / 17191 MGIID:1333813 Length:414 Species:Mus musculus


Alignment Length:212 Identity:50/212 - (23%)
Similarity:70/212 - (33%) Gaps:56/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 GGSSGSSGSKKSKCAPQRRDWPLLDMASLDIASLGLPEIPHDGEWTCHWVNDQPIGTEGFLIVGE 442
            ||:.|..|......||:|...|.                              |.|:.|    ..
Mouse   110 GGAGGCGGGSGGGVAPRRDPVPF------------------------------PSGSSG----PG 140

  Fly   443 HQKPTVIVQDWR-----LPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFLESQNL 500
            .:.|.......|     |||||.|....|.:.|  ||.||...|||||:||||..|..:|.:   
Mouse   141 PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGN--- 202

  Fly   501 VYNPDVYDFSIHRRRAKDINAYVYTHGYNPQPPPKPRPMDVSMNSTL---------DQSITSQHS 556
            ..:...:||...:.....:.........:|....|.:|   .:|:||         .|.:|...:
Mouse   203 AVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKP---DLNTTLPIRQTASIFKQPVTKFTN 264

  Fly   557 LPSTPMPVKESQYMEAP 573
            .||..:.....:..|.|
Mouse   265 HPSNKVKSDPQRMNEQP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690 26/79 (33%)
PHD_SF 919..963 CDD:304600
Mbd2NP_034903.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..163 17/86 (20%)
MeCP2_MBD 154..217 CDD:238690 25/65 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..244 3/29 (10%)
MBDa 230..295 CDD:293172 12/55 (22%)
MBD_C 300..390 CDD:290755
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4161
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.