DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MBD-R2 and PHF13

DIOPT Version :9

Sequence 1:NP_731688.2 Gene:MBD-R2 / 41498 FlyBaseID:FBgn0038016 Length:1169 Species:Drosophila melanogaster
Sequence 2:XP_011539064.1 Gene:PHF13 / 148479 HGNCID:22983 Length:309 Species:Homo sapiens


Alignment Length:262 Identity:59/262 - (22%)
Similarity:92/262 - (35%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   748 PKMEPP---SVSPTVESGIKQEDVSLDAG----------PTQS-----FNPSLSRSCKRARLSPS 794
            ||.|.|   |.||...:....:....|||          |...     ..|:|.:..|.:.....
Human    54 PKEELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLD 118

  Fly   795 KRPSGSRKSNRQRSQRRPILSDNPAGHGLTE--QDVEETRQSFNTPTPDTRIDSKKRRSGAATTP 857
            ::.:...|..::|.:|.   ||.|...|...  ..:|.......|||..|..|..:    |.:.|
Human   119 RKKTDKLKKKKKRKRRD---SDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQ----APSDP 176

  Fly   858 ISSIDSPAMGDSVSTPSSNDQTDINAALAPPPAETLSKAPQYIKENGELIRIVRMRQE------- 915
            .|..||       .||||..    .|.::|...:.       ||..|:. .|||..::       
Human   177 CSGWDS-------DTPSSGS----CATVSPDQVKE-------IKTEGKR-TIVRQGKQVVFRDED 222

  Fly   916 -----------------EIINCICEYGEEDGLMIQCELCLCWQHGACNGIVKEADVPDKYVCYIC 963
                             :::.|.|........||:|..|..|.|.:| ..:::::||:.:||..|
Human   223 STGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSC-AKIRKSNVPEVFVCQKC 286

  Fly   964 RN 965
            |:
Human   287 RD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MBD-R2NP_731688.2 THAP 4..86 CDD:283206
TUDOR 292..329 CDD:119391
MeCP2_MBD 449..522 CDD:238690
PHD_SF 919..963 CDD:304600 13/43 (30%)
PHF13XP_011539064.1 PHD_PHF13 241..287 CDD:277102 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1844
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.