DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:232 Identity:59/232 - (25%)
Similarity:105/232 - (45%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPRYPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQL------YVAGGADSLNSR 105
            |...||.||:.   .||  |.|.|.::::::|:|||||.::....:|      .:.||...:::.
Mouse    33 RNALPYQVSLN---SGY--HFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDALEGGEQFIDAA 92

  Fly   106 KQTRFFVVERRWHPQFRV-LGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQR--DSGTQASLVGW 167
            |..|        ||.:.. ...|||.::::.....|:.    .::....|:.  .:||:..:.||
Mouse    93 KIIR--------HPNYNANTYNNDIMLIKLKTAATLNS----RVSTVALPRSCPSAGTRCLVSGW 145

  Fly   168 GRV---GVGKIRKLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVA 229
            |..   |......||.:....:.:..|..|:.......: .|...|:|.:..|.||||.|:  |.
Mouse   146 GNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGKITSNM-FCLGFLEGGKDSCQGDSGGPV--VC 207

  Fly   230 KEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESM 266
            ..:|.|::|:|.......||..:|::..|.:|||:::
Mouse   208 NGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 57/226 (25%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 56/226 (25%)
Tryp_SPc 25..243 CDD:238113 59/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.