DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG18754

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:290 Identity:75/290 - (25%)
Similarity:105/290 - (36%) Gaps:97/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PLLATTVSTTKVISFRPR---------YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQT 87
            |...|...||.|  ||.|         ||::|     |..|...|.:     ..:||:||||   
  Fly    92 PNKQTCGQTTPV--FRDRGAENAELNEYPWMV-----LLLYENRLSL-----IRYVLTAAHC--- 141

  Fly    88 NPTKQLYVAGG------------------ADSLNSRKQTRFFVVE---RRWHPQFRVLGG---ND 128
                   |.||                  .|.:.|..:.....||   ...|..|...||   ||
  Fly   142 -------VIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRND 199

  Fly   129 IAVLRIYPKFP-----------LDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMP 182
            ||:||:  :||           |.|..|        |.:|...|.|  ||     ...:..|.:.
  Fly   200 IALLRL--QFPVRYTKKIQPICLLDAEF--------PLQDLNLQIS--GW-----DPTKSSQTLI 247

  Fly   183 FLTM-ENDECQQSHRF-VFLKPLDICAMHLKGPR--GPCDGDSGAPLMNVAKEK------LYGLL 237
            ..|: |.:.....:|: .|.....:||   .|.|  ..|.|.||:|:|.:....      |.|:.
  Fly   248 TSTVKERNPADCLNRYPSFRSASQVCA---GGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIA 309

  Fly   238 SYGRKACTPLK-PYAFTRINAYSSWIQESM 266
            |||::.|.... |..:|:|..:|.||:.::
  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 68/269 (25%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 67/269 (25%)
Tryp_SPc 108..335 CDD:214473 65/266 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.