DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and PRTN3

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:235 Identity:65/235 - (27%)
Similarity:111/235 - (47%) Gaps:34/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PYIVSIGENLKGY-YKHLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTR--FFV 112
            ||:.|:  .::|. ..|.|.|.::...|||:||||::..|.:.:.|..||.::.:::.|:  |.|
Human    40 PYMASL--QMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSV 102

  Fly   113 VE---RRWHPQFRVLGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDS----GTQASLVGWGRV 170
            .:   ..:..:.::   ||:.::::.....|.    .|:.....||:|.    |||...:|||||
Human   103 AQVFLNNYDAENKL---NDVLLIQLSSPANLS----ASVATVQLPQQDQPVPHGTQCLAMGWGRV 160

  Fly   171 GV--GKIRKLQEMPFLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKL 233
            |.  ...:.|||:....:.          .|.:|.:||....:...|.|.||||.||  :....:
Human   161 GAHDPPAQVLQELNVTVVT----------FFCRPHNICTFVPRRKAGICFGDSGGPL--ICDGII 213

  Fly   234 YGLLSYGRKAC-TPLKPYAFTRINAYSSWIQESMDSMAAR 272
            .|:.|:....| |.|.|..|||:..|..||:.::..:.|:
Human   214 QGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 64/225 (28%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 64/226 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.