DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and ACR

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:253 Identity:71/253 - (28%)
Similarity:115/253 - (45%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSI---GENLKGYYKHLCVGVILSNEFVLSAAHC-IQTNPTKQLYVAGGADSL---NSRK- 106
            :|::||:   ..|...|  |.|.|.:|::.:||:|||| :..|......:..||..:   |::. 
Human    54 WPWMVSLQIFTYNSHRY--HTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPV 116

  Fly   107 ----QTRF---FVVERRWHPQFRVLGGNDIAVLRIYPKFPLDDVRFRSINF-----AGKPQRDSG 159
                |.|:   .::..:::   ....|||||::.|.|  |:...||.....     ||.|:   |
Human   117 KAPLQERYVEKIIIHEKYN---SATEGNDIALVEITP--PISCGRFIGPGCLPHFKAGLPR---G 173

  Fly   160 TQASLV-GWGRVGVGKIRK---LQEMPFLTMENDECQQSHRF-VFLKPLDICAMHLKGPRGPCDG 219
            :|:..| |||.:.....|.   |.|.....::.|.|..:..: ..::|.::||.:..|....|.|
Human   174 SQSCWVAGWGYIEEKAPRPSSILMEARVDLIDLDLCNSTQWYNGRVQPTNVCAGYPVGKIDTCQG 238

  Fly   220 DSGAPLM-NVAKEKLY---GLLSYGRKACTPLKPYAFTRINAYSSWIQESMDSMAARL 273
            |||.||| ..:||..|   |:.|:|.......:|..:|....|.:||...:.|.|.|:
Human   239 DSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWPYLNWIASKIGSNALRM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 68/242 (28%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 66/240 (28%)
Tryp_SPc 43..288 CDD:238113 68/243 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316 71/253 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.