DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG31266

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:230 Identity:68/230 - (29%)
Similarity:110/230 - (47%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQ-TNPTKQLYVAGGAD--SLNSRKQTRFF 111
            :|:|.|| :|...|  |||..:||...:||:||.|:. ..|...|.|.|..|  .|.:...|   
  Fly    63 WPWIASI-QNAYSY--HLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYAPYYT--- 121

  Fly   112 VVERRWHPQF-RVLGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWG-RVGVGK 174
            |.:...|..| :.|..||||:|::..|...:||. ::|..|...:.:.|.:.:..||| ...:|.
  Fly   122 VSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVT-KNITLADIDELEEGDKLTFAGWGSSEAMGT 185

  Fly   175 I-RKLQEMPFLTMENDECQQSHRFVFLKPLD------ICAMHLKGPRGPCDGDSGAPLMNVAKEK 232
            . |.|||.....:..|.|::.     |:..|      :| :.:...:|.|.||:|.||:: .:::
  Fly   186 YGRYLQEASGTYLPVDACREK-----LQNQDDVDLGHVC-VQMDAGQGACHGDTGGPLID-EQQR 243

  Fly   233 LYGLLSYGRKACTPLKPYAFTRINAYSSWIQESMD 267
            |.|:.::| ..|....|..:.|...|..||:.:|:
  Fly   244 LVGIGNWG-VPCGRGYPDVYARTAFYHDWIRTTMN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 67/225 (30%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 65/223 (29%)
Tryp_SPc 52..275 CDD:238113 67/226 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.