DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG11668

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:266 Identity:57/266 - (21%)
Similarity:100/266 - (37%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIG------------ENLKGYYKHLCVGVILSNEFVLSAAHCIQT-NPTKQLYVAGGADS 101
            :||:.::|            .:.|..|...|...:::..|.::||||... ..:..:.:.||.: 
  Fly   159 HPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVE- 222

  Fly   102 LNSRKQTRFFVVERRWHPQF--RVLGGNDIAVLRI----------------YPKFPLDDVRFRSI 148
            |||.:.....:.....||.|  ..| .||:||:::                .|:.||..:.:...
  Fly   223 LNSGRGQLIEIKRISQHPHFDAETL-TNDLAVVKLARRSHMPVACLWNQESLPERPLTALGYGQT 286

  Fly   149 NFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMPFLTMENDECQQSHRFVFLKPLD--------- 204
            .||| |...:                   |.::....:...:||:     :|...|         
  Fly   287 KFAG-PHSSN-------------------LLQIMLYHLNFQQCQR-----YLHNYDKLANGLGSG 326

  Fly   205 -ICAMHLKGPRGPCDGDSGAPLM---NVAKEK-----LYGLLSYGRKACTPLKPYAFTRINAYSS 260
             :||....|....|.||||.||:   ::...:     :.|:.|:| .||...:|..:.||..|..
  Fly   327 QMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFG-GACASGQPGVYVRIAHYIQ 390

  Fly   261 WIQESM 266
            ||::.:
  Fly   391 WIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 57/262 (22%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 57/263 (22%)
Tryp_SPc 149..392 CDD:214473 55/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456076
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.