DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG14642

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:270 Identity:69/270 - (25%)
Similarity:119/270 - (44%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KVISFRPRYPYIVSIG-ENLKGYYKHLCVGVILSNEFVLSAAHC--IQTNPTKQLYVAGGADSLN 103
            :|::....||::.::| |:.:|...:.|.|.::|..|||:||||  |...|.|.:.: |..|..:
  Fly   147 RVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI-GDLDLAS 210

  Fly   104 SRK--QTRFFVVERRW-HPQF-RVLGGNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASL 164
            .::  :.:...:|:.: ||.: :.:..:|||:|::..:..|.:. .|.:.....|:..: |.|..
  Fly   211 EKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEY-VRPVRLWVFPELPT-TIAFA 273

  Fly   165 VGWGRVGVGK--IRKLQEMPFLTMENDECQQSHRFVFLKPL----------DICAMHLKGPRGPC 217
            :|:|.....|  ..:|..:....:.|.||...     |.||          .|||......|..|
  Fly   274 MGYGATSFAKPMTNRLTNLNLTVVPNAECNAE-----LPPLAETPSGVLESQICAQDYILNRDTC 333

  Fly   218 DGDSGAPL-MNVAKEK--------LYGLLSYGRKACTPLKPYAFTRINAYSSWIQESMDSMAARL 273
            .||||.|| :|:...:        |.|:.||| ..|....|..:||::::..||:          
  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG-VFCRSSYPSVYTRVSSFLDWIE---------- 387

  Fly   274 KVLQINRTVW 283
                  .|||
  Fly   388 ------LTVW 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 65/242 (27%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 65/248 (26%)
Tryp_SPc 146..386 CDD:214473 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.