DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG9372

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:223 Identity:59/223 - (26%)
Similarity:98/223 - (43%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRF-------FVVERRWHPQFRVLG 125
            |.||::::..||:|||||.....:.::|..|..:.:...:||.       .|:...::||..   
  Fly   201 CGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHIDYNPQNY--- 262

  Fly   126 GNDIAVLR----------IYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWG--RVGVGKIRKL 178
            .||||::|          |:|      |....:|     :..|...|.:.|||  :.|......|
  Fly   263 DNDIAIVRIDRATIFNTYIWP------VCMPPVN-----EDWSDRNAIVTGWGTQKFGGPHSNIL 316

  Fly   179 QEMPFLTMENDECQQSHRFVFLKP-LDICAMHLKGPRGPCDGDSGAPLMNVAKEKLY---GLLSY 239
            .|:.....:..:|:.|  ||...| ..:||...:|.:..|.||||.||:.....:.:   |::|:
  Fly   317 MEVNLPVWKQSDCRSS--FVQHVPDTAMCAGFPEGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSW 379

  Fly   240 GRKACTPLKPYAFTRINAYSSWIQESMD 267
            |.......:|..:||::.|..||..:.|
  Fly   380 GVGCGQRGRPGIYTRVDRYLDWILANAD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 58/218 (27%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 56/216 (26%)
Tryp_SPc 176..402 CDD:238113 56/216 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.