DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG4998

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:247 Identity:72/247 - (29%)
Similarity:115/247 - (46%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIGENLKGYYK---HLCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFF 111
            ||:.|:|   ||...|   :.|.|.::..:.::||||||::.....|.|..|...:|  ....||
  Fly   948 YPWHVAI---LKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFDLRVRLGEWDVN--HDVEFF 1007

  Fly   112 ------VVERRWHPQFRVLGG---NDIAVLRIYPKFPLDDVRFRSINFAGKPQRDS---GTQASL 164
                  ||....||::  ..|   ||:|||::  ..|:|..:...|:.|..|.:.|   |.:...
  Fly  1008 PYIERDVVSVHIHPEY--YAGTLDNDLAVLKL--DQPVDFTKNPHISPACLPDKYSDFTGARCWT 1068

  Fly   165 VGWGRVGVGKIRKLQ------EMPFLTMENDECQ-QSHRFVF---LKPLDICAMHLKGPRGPCDG 219
            .|||:...|:..|.|      ::|.|:.:..|.| ::.|..:   |.|..:||...:| :..|.|
  Fly  1069 TGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEG-KDACKG 1132

  Fly   220 DSGAPLM---NVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESMDS 268
            |.|.||:   |.|.. :.|::|:|........|..:.:::||..|||:...|
  Fly  1133 DGGGPLVCDRNGAMH-VVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQITQS 1183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 70/241 (29%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 71/242 (29%)
Tryp_SPc 942..1177 CDD:214473 68/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456166
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.