DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG18180

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:124/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MSAAQETLSDTPQ--NSTPLLATTVSTTKVISFRP----RYPYIVSI-----GENLKGYYKHLCV 69
            :|||...::.:|.  |.|.||:.. :..::::..|    :.||||.:     |.|...    :..
  Fly     8 LSAALALVAASPTGLNRTTLLSQG-AEGRIVNGYPAPEGKAPYIVGLFIRTDGSNSGA----VGA 67

  Fly    70 GVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFFVVERR---WHPQFRVLGGNDIAV 131
            |.|::|:::|:||||: |....:::.........:.:||    |.|.   .||.:...||.||.:
  Fly    68 GTIIANDWILTAAHCL-TGDYVEIHYGSNWGWNGAYRQT----VRRDNFISHPDWPSQGGRDIGL 127

  Fly   132 LR--------IYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVGKIRK-LQEMPFLTME 187
            :|        :..|.||..:..::       .|...|.....|||.:..|.:.. ||.:....:.
  Fly   128 IRTPHVDFNGLINKIPLPSMNEQN-------DRYQDTWCVACGWGGMDNGNLADWLQCVDVQIIS 185

  Fly   188 NDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPYAF 252
            |.||:|::..|  ...|:|..|..| :..|.||||.||:.....:|.|::::...:|.. .|..:
  Fly   186 NSECEQAYGSV--ASTDMCTRHADG-KSVCGGDSGGPLVTHDNARLVGVITFASVSCHD-GPSGY 246

  Fly   253 TRINAYSSWIQE 264
            ||::.|..||::
  Fly   247 TRVSDYLEWIRD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 62/231 (27%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 61/240 (25%)
Tryp_SPc 36..259 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.