DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG18179

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:275 Identity:76/275 - (27%)
Similarity:126/275 - (45%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MSAAQETLSDTPQ-NSTPLL-ATTVS---TTKVISFRP----RYPYIVSI-----GENLKGYYKH 66
            :|.|...::.:|. |.|.|| ..|:|   ..::::..|    :.||||.:     |.|...    
  Fly     8 LSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAA---- 68

  Fly    67 LCVGVILSNEFVLSAAHCIQTNPTKQLYVA----GGADSLNSRKQTRFFVVERRWHPQFRVLGGN 127
            :..|.|::::::|:||||:.|:..:..|.:    .||...:.|:..  |:.    ||.:...||.
  Fly    69 VGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDN--FIS----HPNWPAEGGR 127

  Fly   128 DIAVLRIYPKFPLDDVRFRSIN------FAGKPQRDSGTQASLVGWGRVGVGKIRK-LQEMPFLT 185
            ||.::|. |.....|:    ||      |:.:..|...|.....|||.:..|.:.. ||.|....
  Fly   128 DIGLIRT-PSVGFTDL----INKVALPSFSEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQI 187

  Fly   186 MENDECQQSHRFVFLKPLDICAMHLKGPRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPY 250
            :.|.||:||:..|  ...|:|.....| :..|.||||.||:.....:|.|::::|...|.. .|.
  Fly   188 ISNSECEQSYGTV--ASTDMCTRRTDG-KSSCGGDSGGPLVTHDNARLVGVITFGSVDCHS-GPS 248

  Fly   251 AFTRINAYSSWIQES 265
            .:||:..|..||:::
  Fly   249 GYTRVTDYLGWIRDN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 66/230 (29%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/239 (27%)
Tryp_SPc 40..263 CDD:238113 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.