DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and ndl

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_523947.2 Gene:ndl / 38738 FlyBaseID:FBgn0002926 Length:2616 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:115/273 - (42%) Gaps:75/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLY-VAGG-----ADSLNSRKQ 107
            ::|::|:|..|.|.:    |.|.|.|:.:::|||||: .|..|..| |..|     :.|..::.|
  Fly  1155 QWPFVVAIYRNGKFH----CGGTIYSDRWIISAAHCV-INYGKYFYEVRAGLLRRSSYSPATQIQ 1214

  Fly   108 TRFFVV-----ERRWHPQFRVLGGNDIAVLRIYPKFPLDDVRF----RSINFAGKPQRDSG---- 159
            ....||     |||   ..|    ||:::||:     |:.::|    :.|....|.:...|    
  Fly  1215 PVSHVVVHQAYERR---SMR----NDLSLLRL-----LNPLQFNRWVKPICLPDKGRTTVGDDWI 1267

  Fly   160 ------TQASLVGWG------------RVGVGKIRKLQEMPFLTMENDECQQSHRFVFLKPLDIC 206
                  |..::||||            |..:..|||....|       |.|.|.        |||
  Fly  1268 WGPVEHTLCTVVGWGAIREKGPSSDPMRQVIVPIRKKCTDP-------EDQASE--------DIC 1317

  Fly   207 AMHLKGPRGPCDGDSGAPLM-----NVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQ-ES 265
            |....|.|..|.||||.||.     |..:..|.|::|:|.....|.:...:||:..|..|:: .:
  Fly  1318 AGDPDGGRDACQGDSGGPLFCRSVSNPDEFYLAGVVSHGNGCARPQEFGVYTRVTLYLDWLEMAT 1382

  Fly   266 MDSMAARLKVLQI 278
            ...:..:|:.||:
  Fly  1383 TPRLLPKLQPLQL 1395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 72/257 (28%)
ndlNP_523947.2 LDLa 891..927 CDD:238060
Tryp_SPc 1144..1377 CDD:214473 71/253 (28%)
Tryp_SPc 1145..1379 CDD:238113 72/255 (28%)
LDLa 1399..1430 CDD:238060
Metaviral_G 1448..1600 CDD:118131
LDLa 1710..1743 CDD:238060
LDLa 1776..1811 CDD:238060
DUF1986 2041..2158 CDD:286432
LDLa 2309..2339 CDD:197566
LDLa 2350..2383 CDD:197566
LDLa 2421..2457 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.