DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG4927

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:97/270 - (35%) Gaps:85/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YPYIVSIGENLK--GYYKHLCVGVILSNEFVLSAAHCIQTNPTKQ----------LYVAG-GADS 101
            :|::..:|:..|  ......|..:|:..:|||:||||::|:.||:          .||.. |...
  Fly   116 FPFMALLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELD 180

  Fly   102 LNSRKQTRFFVVERRWHPQ-FRVLG----------------GNDIAVLRIYPK-----------F 138
            .||.....        .|| ||||.                .|||||:.:..:           .
  Fly   181 YNSTTDDA--------QPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACL 237

  Fly   139 PLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVG--KIRKLQEMPFLTMENDECQQ--SHRFVF 199
            |||         .|..|    .|.:..|||.....  ....|.::.....:..||.|  .|:   
  Fly   238 PLD---------GGNEQ----LQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQRLEHK--- 286

  Fly   200 LKPLDI----CAMHLKGPRGPCDGDSGAPLMNVAKEKLY-------GLLSYGRKACTPLKPYAFT 253
               :|:    ||.........|.||||.|:.  .:..:|       |:.|||........|..:|
  Fly   287 ---IDVRTQLCAGSRSTSADTCYGDSGGPVF--VQHPIYSCLKQVIGITSYGLVCGVQGLPSVYT 346

  Fly   254 RINAYSSWIQ 263
            :::.|:.||:
  Fly   347 KVHLYTDWIE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 64/270 (24%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 64/270 (24%)
Tryp_SPc 105..355 CDD:214473 62/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456070
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.