DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and Ser7

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:331 Identity:84/331 - (25%)
Similarity:135/331 - (40%) Gaps:74/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCCWQSLCSIAWFAAMSAAQETLSDTPQNSTPLL-ATTVSTTKVISFRPRYPYIVS------IG- 57
            :||.:....|...|...:...|.:.:...:..|| .||......|...|.:||..|      :| 
  Fly    71 VCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGG 135

  Fly    58 ----------------ENLKGYYKHLCVGVILSNEFVLSAAHCIQT---NPTKQLYVAGGADS-- 101
                            |.:.|...:.|....::..::|:|||||.|   |.|..:......|:  
  Fly   136 HNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDP 200

  Fly   102 -----LNSRKQ-----TRFFVVERRWHPQFRVLG-GNDIAVLRIYPKFPLDDVRFRSIN-FAGKP 154
                 ||..::     .|..:.....|.|:..|. .||||:||:  ..|::.::.:::. ....|
  Fly   201 DCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRL--SRPVNWLQMQNLEPVCLPP 263

  Fly   155 QRD------SGTQASLVGWGRVGVGKIRKLQEMPFLTME-NDECQQSHRFVFLKPLDI------- 205
            ||.      :|:.|.:.|||:.......|:::...|.:: .|:||::    |.|...|       
  Fly   264 QRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA----FYKDTKITLADSQM 324

  Fly   206 CAMHLKGPRG--PCDGDSGAPL---MNVAKEKLY----GLLSYGRKAC-TPLKPYAFTRINAYSS 260
            ||   .|..|  .|.||||.||   .|.|....|    |::|.|||.| |.|....:||:::|..
  Fly   325 CA---GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMD 386

  Fly   261 WIQESM 266
            ||:.::
  Fly   387 WIESTI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 73/278 (26%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829 1/2 (50%)
Tryp_SPc 131..388 CDD:214473 68/265 (26%)
Tryp_SPc 133..391 CDD:238113 70/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.