DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and CG1632

DIOPT Version :10

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_572467.1 Gene:CG1632 / 31763 FlyBaseID:FBgn0030027 Length:1056 Species:Drosophila melanogaster


Alignment Length:304 Identity:62/304 - (20%)
Similarity:107/304 - (35%) Gaps:92/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CWQSLCSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSI-GENLKGYYKH 66
            |.:..|.:.  :|:..|::.|| .|:.|.|               ..:|::|:: .|::     |
  Fly   684 CGELRCGVQ--SALFNAKQHLS-LPKMSAP---------------GDWPWLVALFREDI-----H 725

  Fly    67 LCVGVILSNEFVLSAAHCIQTNPTKQLYVAGGADSLNSRKQTRFFVVERRWHPQFRVLG------ 125
            :|.|.:::.::||:...|.|..|........||..|:::..         |..:.|::|      
  Fly   726 VCDGTLITQDWVLTTEGCFQGQPRATWMAIVGAVRLSAKAP---------WTQRRRIIGMIKSPV 781

  Fly   126 -GNDIAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMP------- 182
             |:..|::|:.......| ..|.|......||                   |.||:.|       
  Fly   782 EGSTAALVRLETPVSYSD-HVRPICLPDALQR-------------------RLLQQPPAQRRSHV 826

  Fly   183 ---------FLTMENDECQQSHRFVFLKPLDICAMHLKGPRGPCD---------GDSGAPLMNVA 229
                     .::.:.....|.::..||.|...........:|..|         |:|.|..|..|
  Fly   827 PVAERLEGQLVSQQRSRLSQENQQFFLIPSQEQQDSSTENQGDEDQDEQEDHFGGESAASYMPKA 891

  Fly   230 KEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESMDSMAARL 273
            :.....|..|      ||..:| .::|.|||....:..|.|||:
  Fly   892 EALHQELDGY------PLPDHA-PQVNYYSSSSTVTSSSTAARI 928

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 49/247 (20%)
CG1632NP_572467.1 SEA 232..>309 CDD:460188
CRD_FZ 384..502 CDD:143549
PRKCSH-like <503..>582 CDD:372423
LDLa 536..571 CDD:238060
Tryp_SPc 708..>809 CDD:473915 25/130 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.