DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10041 and GZMH

DIOPT Version :9

Sequence 1:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_219491.1 Gene:GZMH / 2999 HGNCID:4710 Length:246 Species:Homo sapiens


Alignment Length:249 Identity:69/249 - (27%)
Similarity:117/249 - (46%) Gaps:31/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLATTVSTTKVI---SFRPR-YPYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQL 93
            ||.....|.::|   ..:|. .||:..: :.|:...:..|.|:::..:|||:||||    ....:
Human    11 LLTPGAGTEEIIGGHEAKPHSRPYMAFV-QFLQEKSRKRCGGILVRKDFVLTAAHC----QGSSI 70

  Fly    94 YVAGGADSLNSRKQTRFFVVERR--WHPQFRVLG-GNDIAVLRIYPKF-------PLDDVRFRSI 148
            .|..||.::..:::|:.|:..:|  .||.:.... .|||.:|::..|.       ||   |..| 
Human    71 NVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPL---RLPS- 131

  Fly   149 NFAGKPQRDSGTQASLVGWGRVGVGKIRKLQEMPFLTMEND-ECQQSHRFVFLKPLDICAMHLKG 212
               .|.|...|...|:.|||.|.:..:....:...||::.| :|::.....:.:..:||....|.
Human   132 ---SKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKK 193

  Fly   213 PRGPCDGDSGAPLMNVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWIQESM 266
            .:....||||.||  |.|:...|:||||.|..||  |..:.:::.:..||:.:|
Human   194 TQTGFKGDSGGPL--VCKDVAQGILSYGNKKGTP--PGVYIKVSHFLPWIKRTM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 63/226 (28%)
GZMHNP_219491.1 Tryp_SPc 21..242 CDD:238113 65/236 (28%)
Mediates the preference for acidic residues at the P3' and P4' sites 46..48 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.